| Brand: | Abnova |
| Reference: | H00002005-M02 |
| Product name: | ELK4 monoclonal antibody (M02), clone 3D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELK4. |
| Clone: | 3D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2005 |
| Gene name: | ELK4 |
| Gene alias: | SAP1 |
| Gene description: | ELK4, ETS-domain protein (SRF accessory protein 1) |
| Genbank accession: | NM_001973 |
| Immunogen: | ELK4 (NP_001964.2, 118 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA |
| Protein accession: | NP_001964.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ELK4 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |