ELK3 monoclonal antibody (M02), clone 3A12 View larger

ELK3 monoclonal antibody (M02), clone 3A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELK3 monoclonal antibody (M02), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ELK3 monoclonal antibody (M02), clone 3A12

Brand: Abnova
Reference: H00002004-M02
Product name: ELK3 monoclonal antibody (M02), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant ELK3.
Clone: 3A12
Isotype: IgG2a Kappa
Gene id: 2004
Gene name: ELK3
Gene alias: ERP|NET|SAP2
Gene description: ELK3, ETS-domain protein (SRF accessory protein 2)
Genbank accession: NM_005230
Immunogen: ELK3 (NP_005221.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Protein accession: NP_005221.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002004-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002004-M02-13-15-1.jpg
Application image note: Western Blot analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody (M02), clone 3A12.

Lane 1: ELK3 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ELK3 monoclonal antibody (M02), clone 3A12 now

Add to cart