Cart 2 Product Products 713,00 € (empty)
No products
To be determined Shipping
713,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 713,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 713,00 €
Data sheet of ELK1 monoclonal antibody (M01), clone 2G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,PLA-Ce |
More info about ELK1 monoclonal antibody (M01), clone 2G6
| Brand: | Abnova |
| Reference: | H00002002-M01 |
| Product name: | ELK1 monoclonal antibody (M01), clone 2G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELK1. |
| Clone: | 2G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2002 |
| Gene name: | ELK1 |
| Gene alias: | - |
| Gene description: | ELK1, member of ETS oncogene family |
| Genbank accession: | NM_005229 |
| Immunogen: | ELK1 (NP_005220, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS |
| Protein accession: | NP_005220 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ELK1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |