Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of ELF3 monoclonal antibody (M05), clone 2G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ELF3 monoclonal antibody (M05), clone 2G9
| Brand: | Abnova |
| Reference: | H00001999-M05 |
| Product name: | ELF3 monoclonal antibody (M05), clone 2G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELF3. |
| Clone: | 2G9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1999 |
| Gene name: | ELF3 |
| Gene alias: | EPR-1|ERT|ESE-1|ESX |
| Gene description: | E74-like factor 3 (ets domain transcription factor, epithelial-specific ) |
| Genbank accession: | BC003569 |
| Immunogen: | ELF3 (AAH03569, 262 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN |
| Protein accession: | AAH03569 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ELF3 monoclonal antibody (M05), clone 2G9 Western Blot analysis of ELF3 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |