ELF3 monoclonal antibody (M05), clone 2G9 View larger

ELF3 monoclonal antibody (M05), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELF3 monoclonal antibody (M05), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ELF3 monoclonal antibody (M05), clone 2G9

Brand: Abnova
Reference: H00001999-M05
Product name: ELF3 monoclonal antibody (M05), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant ELF3.
Clone: 2G9
Isotype: IgG1 Kappa
Gene id: 1999
Gene name: ELF3
Gene alias: EPR-1|ERT|ESE-1|ESX
Gene description: E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Genbank accession: BC003569
Immunogen: ELF3 (AAH03569, 262 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Protein accession: AAH03569
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001999-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001999-M05-1-4-1.jpg
Application image note: ELF3 monoclonal antibody (M05), clone 2G9 Western Blot analysis of ELF3 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ELF3 monoclonal antibody (M05), clone 2G9 now

Add to cart