| Brand:  | Abnova | 
| Reference:  | H00001999-M04 | 
| Product name:  | ELF3 monoclonal antibody (M04), clone 1F12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant ELF3. | 
| Clone:  | 1F12 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 1999 | 
| Gene name:  | ELF3 | 
| Gene alias:  | EPR-1|ERT|ESE-1|ESX | 
| Gene description:  | E74-like factor 3 (ets domain transcription factor, epithelial-specific ) | 
| Genbank accession:  | BC003569 | 
| Immunogen:  | ELF3 (AAH03569, 262 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN | 
| Protein accession:  | AAH03569 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | ELF3 monoclonal antibody (M04), clone 1F12 Western Blot analysis of ELF3 expression in A-431 ( Cat # L015V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |