Brand: | Abnova |
Reference: | H00001997-M01 |
Product name: | ELF1 monoclonal antibody (M01), clone 3B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ELF1. |
Clone: | 3B7 |
Isotype: | IgG2b Kappa |
Gene id: | 1997 |
Gene name: | ELF1 |
Gene alias: | - |
Gene description: | E74-like factor 1 (ets domain transcription factor) |
Genbank accession: | NM_172373 |
Immunogen: | ELF1 (NP_758961, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTV |
Protein accession: | NP_758961 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ELF1 monoclonal antibody (M01), clone 3B7 Western Blot analysis of ELF1 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |