No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00001995-B01P |
Product name: | ELAVL3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ELAVL3 protein. |
Gene id: | 1995 |
Gene name: | ELAVL3 |
Gene alias: | DKFZp547J036|HUC|HUCL|MGC20653|PLE21 |
Gene description: | ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C) |
Genbank accession: | BC014144 |
Immunogen: | ELAVL3 (AAH11875, 1 a.a. ~ 367 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA |
Protein accession: | AAH11875 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | ELAVL3 MaxPab polyclonal antibody. Western Blot analysis of ELAVL3 expression in rat brain. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |