Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00001995-B01P |
| Product name: | ELAVL3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ELAVL3 protein. |
| Gene id: | 1995 |
| Gene name: | ELAVL3 |
| Gene alias: | DKFZp547J036|HUC|HUCL|MGC20653|PLE21 |
| Gene description: | ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C) |
| Genbank accession: | BC014144 |
| Immunogen: | ELAVL3 (AAH11875, 1 a.a. ~ 367 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA |
| Protein accession: | AAH11875 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ELAVL3 MaxPab polyclonal antibody. Western Blot analysis of ELAVL3 expression in rat brain. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |