No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA | 
| Brand: | Abnova | 
| Reference: | H00001991-M08J | 
| Product name: | ELA2 monoclonal antibody (M08J), clone 2D10 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELA2. | 
| Clone: | 2D10 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 1991 | 
| Gene name: | ELA2 | 
| Gene alias: | GE|HLE|HNE|NE|PMN-E | 
| Gene description: | elastase 2, neutrophil | 
| Genbank accession: | NM_001972 | 
| Immunogen: | ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH | 
| Protein accession: | NP_001963 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Applications: | ELISA | 
| Shipping condition: | Dry Ice |