No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00001991-M06J |
Product name: | ELA2 monoclonal antibody (M06J), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ELA2. |
Clone: | 3B1 |
Isotype: | IgG1 Kappa |
Gene id: | 1991 |
Gene name: | ELA2 |
Gene alias: | GE|HLE|HNE|NE|PMN-E |
Gene description: | elastase 2, neutrophil |
Genbank accession: | NM_001972 |
Immunogen: | ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
Protein accession: | NP_001963 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |