| Brand:  | Abnova | 
| Reference:  | H00001991-M05A | 
| Product name:  | ELA2 monoclonal antibody (M05A), clone 3E5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant ELA2. | 
| Clone:  | 3E5 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 1991 | 
| Gene name:  | ELA2 | 
| Gene alias:  | GE|HLE|HNE|NE|PMN-E | 
| Gene description:  | elastase 2, neutrophil | 
| Genbank accession:  | NM_001972 | 
| Immunogen:  | ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH | 
| Protein accession:  | NP_001963 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |