ELA2 monoclonal antibody (M01), clone 4E11 View larger

ELA2 monoclonal antibody (M01), clone 4E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELA2 monoclonal antibody (M01), clone 4E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about ELA2 monoclonal antibody (M01), clone 4E11

Brand: Abnova
Reference: H00001991-M01
Product name: ELA2 monoclonal antibody (M01), clone 4E11
Product description: Mouse monoclonal antibody raised against a partial recombinant ELA2.
Clone: 4E11
Isotype: IgG2a Kappa
Gene id: 1991
Gene name: ELA2
Gene alias: GE|HLE|HNE|NE|PMN-E
Gene description: elastase 2, neutrophil
Genbank accession: NM_001972
Immunogen: ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Protein accession: NP_001963
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001991-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001991-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ELA2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ELA2 monoclonal antibody (M01), clone 4E11 now

Add to cart