Cart 24 Product Products 6 782,16 € (empty)
-
-
-
-
-
1 x Ghrelin...474,00 € -
1 x Phospho-Se...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
6 782,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 24 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 782,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 782,16 €
Data sheet of ELA1 monoclonal antibody (M02), clone 4H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about ELA1 monoclonal antibody (M02), clone 4H5
| Brand: | Abnova |
| Reference: | H00001990-M02 |
| Product name: | ELA1 monoclonal antibody (M02), clone 4H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELA1. |
| Clone: | 4H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1990 |
| Gene name: | ELA1 |
| Gene alias: | - |
| Gene description: | elastase 1, pancreatic |
| Genbank accession: | NM_001971 |
| Immunogen: | ELA1 (NP_001962.3, 159 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS |
| Protein accession: | NP_001962.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |