ELA1 monoclonal antibody (M02), clone 4H5 View larger

ELA1 monoclonal antibody (M02), clone 4H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELA1 monoclonal antibody (M02), clone 4H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about ELA1 monoclonal antibody (M02), clone 4H5

Brand: Abnova
Reference: H00001990-M02
Product name: ELA1 monoclonal antibody (M02), clone 4H5
Product description: Mouse monoclonal antibody raised against a partial recombinant ELA1.
Clone: 4H5
Isotype: IgG2a Kappa
Gene id: 1990
Gene name: ELA1
Gene alias: -
Gene description: elastase 1, pancreatic
Genbank accession: NM_001971
Immunogen: ELA1 (NP_001962.3, 159 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS
Protein accession: NP_001962.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001990-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001990-M02-3-8-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ELA1 monoclonal antibody (M02), clone 4H5 now

Add to cart