Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF5A monoclonal antibody (M01), clone 8C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EIF5A monoclonal antibody (M01), clone 8C1
| Brand: | Abnova |
| Reference: | H00001984-M01 |
| Product name: | EIF5A monoclonal antibody (M01), clone 8C1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EIF5A. |
| Clone: | 8C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1984 |
| Gene name: | EIF5A |
| Gene alias: | EIF-5A|EIF5A1|MGC104255|MGC99547|eIF5AI |
| Gene description: | eukaryotic translation initiation factor 5A |
| Genbank accession: | NM_001970.3 |
| Immunogen: | EIF5A (NP_001961.1, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
| Protein accession: | NP_001961.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EIF5A expression in transfected 293T cell line by EIF5A monoclonal antibody (M01), clone 8C1. Lane 1: EIF5A transfected lysate(16.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |