Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF4G2 monoclonal antibody (M01), clone 3B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about EIF4G2 monoclonal antibody (M01), clone 3B5
| Brand: | Abnova |
| Reference: | H00001982-M01 |
| Product name: | EIF4G2 monoclonal antibody (M01), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF4G2. |
| Clone: | 3B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1982 |
| Gene name: | EIF4G2 |
| Gene alias: | AAG1|DAP5|FLJ41344|NAT1|p97 |
| Gene description: | eukaryotic translation initiation factor 4 gamma, 2 |
| Genbank accession: | NM_001418 |
| Immunogen: | EIF4G2 (NP_001409, 811 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ |
| Protein accession: | NP_001409 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P Mol Cell Proteomics. 2014 Oct 2. pii: mcp.M114.041228. |