Cart 5 Product Products 967,11 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 967,11 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 967,11 €
Data sheet of EIF4G1 monoclonal antibody (M10), clone 2A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EIF4G1 monoclonal antibody (M10), clone 2A9
| Brand: | Abnova |
| Reference: | H00001981-M10 |
| Product name: | EIF4G1 monoclonal antibody (M10), clone 2A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF4G1. |
| Clone: | 2A9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1981 |
| Gene name: | EIF4G1 |
| Gene alias: | DKFZp686A1451|EIF4F|EIF4G|p220 |
| Gene description: | eukaryotic translation initiation factor 4 gamma, 1 |
| Genbank accession: | NM_182917 |
| Immunogen: | EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN |
| Protein accession: | NP_886553 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to EIF4G1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |