EIF4G1 monoclonal antibody (M01), clone 3A10 View larger

EIF4G1 monoclonal antibody (M01), clone 3A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF4G1 monoclonal antibody (M01), clone 3A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about EIF4G1 monoclonal antibody (M01), clone 3A10

Brand: Abnova
Reference: H00001981-M01
Product name: EIF4G1 monoclonal antibody (M01), clone 3A10
Product description: Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
Clone: 3A10
Isotype: IgG2a Kappa
Gene id: 1981
Gene name: EIF4G1
Gene alias: DKFZp686A1451|EIF4F|EIF4G|p220
Gene description: eukaryotic translation initiation factor 4 gamma, 1
Genbank accession: NM_182917
Immunogen: EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Protein accession: NP_886553
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001981-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00001981-M01-1-19-1.jpg
Application image note: EIF4G1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of EIF4G1 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EIF4G1 monoclonal antibody (M01), clone 3A10 now

Add to cart