View larger

EIF4G1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of EIF4G1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00001981-A01
Product name:	EIF4G1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant EIF4G1.
Gene id:	1981
Gene name:	EIF4G1
Gene alias:	DKFZp686A1451\|EIF4F\|EIF4G\|p220
Gene description:	eukaryotic translation initiation factor 4 gamma, 1
Genbank accession:	NM_182917
Immunogen:	EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Protein accession:	NP_886553
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice