Brand: | Abnova |
Reference: | H00001979-M04 |
Product name: | EIF4EBP2 monoclonal antibody (M04), clone 2G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2. |
Clone: | 2G8 |
Isotype: | IgG2a Kappa |
Gene id: | 1979 |
Gene name: | EIF4EBP2 |
Gene alias: | 4EBP2|PHASII |
Gene description: | eukaryotic translation initiation factor 4E binding protein 2 |
Genbank accession: | NM_004096 |
Immunogen: | EIF4EBP2 (NP_004087, 61 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
Protein accession: | NP_004087 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |