Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2
| Brand: | Abnova |
| Reference: | H00001978-M01 |
| Product name: | EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EIF4EBP1. |
| Clone: | 4F3-H2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1978 |
| Gene name: | EIF4EBP1 |
| Gene alias: | 4E-BP1|4EBP1|BP-1|MGC4316|PHAS-I |
| Gene description: | eukaryotic translation initiation factor 4E binding protein 1 |
| Genbank accession: | BC004459 |
| Immunogen: | EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
| Protein accession: | AAH04459 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between BUB1 and EIF4EBP1. HeLa cells were stained with anti-BUB1 rabbit purified polyclonal 1:1200 and anti-EIF4EBP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |