Brand: | Abnova |
Reference: | H00001969-M02 |
Product name: | EPHA2 monoclonal antibody (M02), clone 1E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHA2. |
Clone: | 1E3 |
Isotype: | IgG3 Kappa |
Gene id: | 1969 |
Gene name: | EPHA2 |
Gene alias: | ECK |
Gene description: | EPH receptor A2 |
Genbank accession: | BC037166 |
Immunogen: | EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT |
Protein accession: | AAH37166 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to EPHA2 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |