Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPHA2 monoclonal antibody (M01), clone 6F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about EPHA2 monoclonal antibody (M01), clone 6F8
| Brand: | Abnova |
| Reference: | H00001969-M01 |
| Product name: | EPHA2 monoclonal antibody (M01), clone 6F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHA2. |
| Clone: | 6F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1969 |
| Gene name: | EPHA2 |
| Gene alias: | ECK |
| Gene description: | EPH receptor A2 |
| Genbank accession: | BC037166 |
| Immunogen: | EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT |
| Protein accession: | AAH37166 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EPHA2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L. J Pathol. 2011 Jul;224(3):377-88. doi: 10.1002/path.2871. Epub 2011 Apr 19. |