Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF2S3 monoclonal antibody (M03), clone 1H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about EIF2S3 monoclonal antibody (M03), clone 1H3
| Brand: | Abnova |
| Reference: | H00001968-M03 |
| Product name: | EIF2S3 monoclonal antibody (M03), clone 1H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF2S3. |
| Clone: | 1H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1968 |
| Gene name: | EIF2S3 |
| Gene alias: | EIF2|EIF2G|EIF2gamma|eIF-2gA |
| Gene description: | eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa |
| Genbank accession: | NM_001415 |
| Immunogen: | EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD |
| Protein accession: | NP_001406 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |