Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of EGFR polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EGFR polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001956-A01 |
| Product name: | EGFR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EGFR. |
| Gene id: | 1956 |
| Gene name: | EGFR |
| Gene alias: | ERBB|ERBB1|HER1|PIG61|mENA |
| Gene description: | epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) |
| Genbank accession: | NM_005228 |
| Immunogen: | EGFR (NP_005219, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNY |
| Protein accession: | NP_005219 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Integrin alphavbeta3 mediates upregulation of epidermal growth-factor receptor expression and activity in human ovarian cancer cells.Lossner D, Abou-Ajram C, Benge A, Reuning U. Int J Biochem Cell Biol. 2008;40(12):2746-61. Epub 2008 Jun 5. |