No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001956-A01 |
Product name: | EGFR polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EGFR. |
Gene id: | 1956 |
Gene name: | EGFR |
Gene alias: | ERBB|ERBB1|HER1|PIG61|mENA |
Gene description: | epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) |
Genbank accession: | NM_005228 |
Immunogen: | EGFR (NP_005219, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNY |
Protein accession: | NP_005219 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Integrin alphavbeta3 mediates upregulation of epidermal growth-factor receptor expression and activity in human ovarian cancer cells.Lossner D, Abou-Ajram C, Benge A, Reuning U. Int J Biochem Cell Biol. 2008;40(12):2746-61. Epub 2008 Jun 5. |