| Brand: | Abnova |
| Reference: | H00001950-M01C |
| Product name: | EGF monoclonal antibody (M01C), clone 2F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EGF. |
| Clone: | 2F1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1950 |
| Gene name: | EGF |
| Gene alias: | HOMG4|URG |
| Gene description: | epidermal growth factor (beta-urogastrone) |
| Genbank accession: | NM_001963 |
| Immunogen: | EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA |
| Protein accession: | NP_001954 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |