No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,IP |
| Brand: | Abnova |
| Reference: | H00001944-M10 |
| Product name: | EFNA3 monoclonal antibody (M10), clone 2H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EFNA3. |
| Clone: | 2H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1944 |
| Gene name: | EFNA3 |
| Gene alias: | EFL2|EPLG3|Ehk1-L|LERK3 |
| Gene description: | ephrin-A3 |
| Genbank accession: | NM_004952 |
| Immunogen: | EFNA3 (NP_004943, 45 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY |
| Protein accession: | NP_004943 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |