No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,IP |
Brand: | Abnova |
Reference: | H00001944-M10 |
Product name: | EFNA3 monoclonal antibody (M10), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EFNA3. |
Clone: | 2H3 |
Isotype: | IgG2a Kappa |
Gene id: | 1944 |
Gene name: | EFNA3 |
Gene alias: | EFL2|EPLG3|Ehk1-L|LERK3 |
Gene description: | ephrin-A3 |
Genbank accession: | NM_004952 |
Immunogen: | EFNA3 (NP_004943, 45 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY |
Protein accession: | NP_004943 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,IP |
Shipping condition: | Dry Ice |