No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP |
| Brand: | Abnova |
| Reference: | H00001944-M02 |
| Product name: | EFNA3 monoclonal antibody (M02), clone 1C12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EFNA3. |
| Clone: | 1C12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1944 |
| Gene name: | EFNA3 |
| Gene alias: | EFL2|EPLG3|Ehk1-L|LERK3 |
| Gene description: | ephrin-A3 |
| Genbank accession: | BC017722 |
| Immunogen: | EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
| Protein accession: | AAH17722 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged EFNA3 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |