Cart 43 Product Products 12 734,75 € (empty)
-
1 x IKKγ...259,07 € -
1 x Synapsin I...259,07 € -
-
-
-
-
-
-
-
-
1 x CXCR-3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Myosin VI...259,07 € -
1 x CDHF10...259,07 € -
1 x Rho H...259,07 € -
-
-
-
1 x NOS1...259,07 € -
-
-
-
-
-
1 x Olfactory...259,07 € -
-
-
-
-
-
-
No products
To be determined Shipping
12 734,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 43 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 734,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 734,75 €
Data sheet of EFNA3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about EFNA3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00001944-D01P |
| Product name: | EFNA3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human EFNA3 protein. |
| Gene id: | 1944 |
| Gene name: | EFNA3 |
| Gene alias: | EFL2|EPLG3|Ehk1-L|LERK3 |
| Gene description: | ephrin-A3 |
| Genbank accession: | NM_004952.3 |
| Immunogen: | EFNA3 (NP_004943.1, 1 a.a. ~ 238 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
| Protein accession: | NP_004943.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EFNA3 expression in transfected 293T cell line (H00001944-T01) by EFNA3 MaxPab polyclonal antibody. Lane 1: EFNA3 transfected lysate(26.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |