Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF2D monoclonal antibody (M05), clone 2D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EIF2D monoclonal antibody (M05), clone 2D10
| Brand: | Abnova |
| Reference: | H00001939-M05 |
| Product name: | EIF2D monoclonal antibody (M05), clone 2D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF2D. |
| Clone: | 2D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1939 |
| Gene name: | EIF2D |
| Gene alias: | LGTN; HCA56 |
| Gene description: | eukaryotic translation initiation factor 2D |
| Genbank accession: | NM_006893 |
| Immunogen: | EIF2D (NP_008824.2, 485 a.a. ~ 584 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK |
| Protein accession: | NP_008824.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EIF2D expression in transfected 293T cell line by EIF2D monoclonal antibody (M05), clone 2D10. Lane 1: EIF2D transfected lysate (Predicted MW: 64.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |