| Brand: | Abnova |
| Reference: | H00001937-M01 |
| Product name: | EEF1G monoclonal antibody (M01), clone 3F11-1A10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EEF1G. |
| Clone: | 3F11-1A10 |
| Isotype: | IgG1 kappa |
| Gene id: | 1937 |
| Gene name: | EEF1G |
| Gene alias: | EF1G|GIG35 |
| Gene description: | eukaryotic translation elongation factor 1 gamma |
| Genbank accession: | BC015813 |
| Immunogen: | EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK |
| Protein accession: | AAH15813.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (73.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to EEF1G on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | The eEF1 gamma Subunit Contacts RNA Polymerase II and Binds Vimentin Promoter Region.Corbi N, Batassa EM, Pisani C, Onori A, Di Certo MG, Strimpakos G, Fanciulli M, Mattei E, Passananti C. PLoS One. 2010 Dec 31;5(12):e14481. |