| Brand: | Abnova |
| Reference: | H00001933-M18 |
| Product name: | EEF1B2 monoclonal antibody (M18), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EEF1B2. |
| Clone: | 2G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1933 |
| Gene name: | EEF1B2 |
| Gene alias: | EEF1B|EEF1B1|EF1B |
| Gene description: | eukaryotic translation elongation factor 1 beta 2 |
| Genbank accession: | BC000211 |
| Immunogen: | EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI |
| Protein accession: | AAH00211 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.49 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EEF1B2 monoclonal antibody (M18), clone 2G10. Western Blot analysis of EEF1B2 expression in HepG2. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |