No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001933-M13 |
Product name: | EEF1B2 monoclonal antibody (M13), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant EEF1B2. |
Clone: | 4G8 |
Isotype: | IgG1 Kappa |
Gene id: | 1933 |
Gene name: | EEF1B2 |
Gene alias: | EEF1B|EEF1B1|EF1B |
Gene description: | eukaryotic translation elongation factor 1 beta 2 |
Genbank accession: | BC000211 |
Immunogen: | EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI |
Protein accession: | AAH00211 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (50.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | EEF1B2 monoclonal antibody (M13), clone 4G8. Western Blot analysis of EEF1B2 expression in HepG2. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |