Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EEF1B2 monoclonal antibody (M10), clone 3A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EEF1B2 monoclonal antibody (M10), clone 3A5
| Brand: | Abnova |
| Reference: | H00001933-M10 |
| Product name: | EEF1B2 monoclonal antibody (M10), clone 3A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EEF1B2. |
| Clone: | 3A5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1933 |
| Gene name: | EEF1B2 |
| Gene alias: | EEF1B|EEF1B1|EF1B |
| Gene description: | eukaryotic translation elongation factor 1 beta 2 |
| Genbank accession: | NM_001959.3 |
| Immunogen: | EEF1B2 (NP_001950.1, 29 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG |
| Protein accession: | NP_001950.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EEF1B2 monoclonal antibody (M10), clone 3A5. Western Blot analysis of EEF1B2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer.Veremieva M, Kapustian L, Khoruzhenko A, Zakharychev V, Negrutskii B BMC Cancer. 2014 Dec 3;14(1):913. |