Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EDN3 monoclonal antibody (M01), clone 2A6-2A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about EDN3 monoclonal antibody (M01), clone 2A6-2A4
| Brand: | Abnova |
| Reference: | H00001908-M01 |
| Product name: | EDN3 monoclonal antibody (M01), clone 2A6-2A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EDN3. |
| Clone: | 2A6-2A4 |
| Isotype: | IgG1 kappa |
| Gene id: | 1908 |
| Gene name: | EDN3 |
| Gene alias: | ET3|MGC15067|MGC61498 |
| Gene description: | endothelin 3 |
| Genbank accession: | BC008876 |
| Immunogen: | EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP |
| Protein accession: | AAH08876 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EDN3 monoclonal antibody (M01), clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP ( Cat # L004V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |