No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00001908-M01 |
Product name: | EDN3 monoclonal antibody (M01), clone 2A6-2A4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant EDN3. |
Clone: | 2A6-2A4 |
Isotype: | IgG1 kappa |
Gene id: | 1908 |
Gene name: | EDN3 |
Gene alias: | ET3|MGC15067|MGC61498 |
Gene description: | endothelin 3 |
Genbank accession: | BC008876 |
Immunogen: | EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP |
Protein accession: | AAH08876 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (51.92 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | EDN3 monoclonal antibody (M01), clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP ( Cat # L004V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |