Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EDN2 monoclonal antibody (M01), clone 3B4-1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about EDN2 monoclonal antibody (M01), clone 3B4-1C5
| Brand: | Abnova |
| Reference: | H00001907-M01 |
| Product name: | EDN2 monoclonal antibody (M01), clone 3B4-1C5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EDN2. |
| Clone: | 3B4-1C5 |
| Isotype: | IgG2b kappa |
| Gene id: | 1907 |
| Gene name: | EDN2 |
| Gene alias: | ET2|PPET2 |
| Gene description: | endothelin 2 |
| Genbank accession: | BC034393 |
| Immunogen: | EDN2 (AAH34393, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR |
| Protein accession: | AAH34393 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EDN2 expression in transfected 293T cell line by EDN2 monoclonal antibody (M01), clone 3B4-1C5. Lane 1: EDN2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Estrogen and progesterone regulate expression of the endothelins in the rhesus macaque endometrium.Keator CS, Mah K, Ohm L, Slayden OD. Hum Reprod. 2011 Apr 19. [Epub ahead of print] |