Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EDN1 monoclonal antibody (M01), clone 3D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about EDN1 monoclonal antibody (M01), clone 3D6
| Brand: | Abnova |
| Reference: | H00001906-M01 |
| Product name: | EDN1 monoclonal antibody (M01), clone 3D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EDN1. |
| Clone: | 3D6 |
| Isotype: | IgG2a kappa |
| Gene id: | 1906 |
| Gene name: | EDN1 |
| Gene alias: | ET1|HDLCQ7 |
| Gene description: | endothelin 1 |
| Genbank accession: | BC009720 |
| Immunogen: | EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
| Protein accession: | AAH09720 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6. Lane 1: EDN1 transfected lysate(24 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.Marion A, Dieudonne FX, Patino-Garcia A, Lecanda F, Marie PJ, Modrowski D. Int J Cancer. 2012 Jun 1;130(11):2514-25. doi: 10.1002/ijc.26246. Epub 2011 Aug 16. |