Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EDG3 monoclonal antibody (M02), clone 2G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about EDG3 monoclonal antibody (M02), clone 2G11
| Brand: | Abnova |
| Reference: | H00001903-M02 |
| Product name: | EDG3 monoclonal antibody (M02), clone 2G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EDG3. |
| Clone: | 2G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1903 |
| Gene name: | S1PR3 |
| Gene alias: | EDG-3|EDG3|FLJ37523|FLJ93220|LPB3|MGC71696|S1P3 |
| Gene description: | sphingosine-1-phosphate receptor 3 |
| Genbank accession: | NM_005226 |
| Immunogen: | EDG3 (NP_005217.2, 302 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN |
| Protein accession: | NP_005217.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to S1PR3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |