Brand: | Abnova |
Reference: | H00001901-M03 |
Product name: | EDG1 monoclonal antibody (M03), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDG1. |
Clone: | 1F11 |
Isotype: | IgG3 Kappa |
Gene id: | 1901 |
Gene name: | S1PR1 |
Gene alias: | CHEDG1|D1S3362|ECGF1|EDG-1|EDG1|FLJ58121|S1P1 |
Gene description: | sphingosine-1-phosphate receptor 1 |
Genbank accession: | BC018650 |
Immunogen: | EDG1 (AAH18650, 1 a.a. ~ 47 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL |
Protein accession: | AAH18650 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (30.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |