| Brand: | Abnova |
| Reference: | H00001901-M03 |
| Product name: | EDG1 monoclonal antibody (M03), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EDG1. |
| Clone: | 1F11 |
| Isotype: | IgG3 Kappa |
| Gene id: | 1901 |
| Gene name: | S1PR1 |
| Gene alias: | CHEDG1|D1S3362|ECGF1|EDG-1|EDG1|FLJ58121|S1P1 |
| Gene description: | sphingosine-1-phosphate receptor 1 |
| Genbank accession: | BC018650 |
| Immunogen: | EDG1 (AAH18650, 1 a.a. ~ 47 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL |
| Protein accession: | AAH18650 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |