EDA monoclonal antibody (M12), clone 4D6 View larger

EDA monoclonal antibody (M12), clone 4D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDA monoclonal antibody (M12), clone 4D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about EDA monoclonal antibody (M12), clone 4D6

Brand: Abnova
Reference: H00001896-M12
Product name: EDA monoclonal antibody (M12), clone 4D6
Product description: Mouse monoclonal antibody raised against a partial recombinant EDA.
Clone: 4D6
Isotype: IgG2b Kappa
Gene id: 1896
Gene name: EDA
Gene alias: ED1|ED1-A1|ED1-A2|EDA1|EDA2|HED|XHED|XLHED
Gene description: ectodysplasin A
Genbank accession: NM_001399.1
Immunogen: EDA (NP_001390.1 , 245 a.a. ~ 391 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Protein accession: NP_001390.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy EDA monoclonal antibody (M12), clone 4D6 now

Add to cart