EDA monoclonal antibody (M01), clone 3E12 View larger

EDA monoclonal antibody (M01), clone 3E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDA monoclonal antibody (M01), clone 3E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EDA monoclonal antibody (M01), clone 3E12

Brand: Abnova
Reference: H00001896-M01
Product name: EDA monoclonal antibody (M01), clone 3E12
Product description: Mouse monoclonal antibody raised against a partial recombinant EDA.
Clone: 3E12
Isotype: IgG2a Kappa
Gene id: 1896
Gene name: EDA
Gene alias: ED1|ED1-A1|ED1-A2|EDA1|EDA2|HED|XHED|XLHED
Gene description: ectodysplasin A
Genbank accession: NM_001399.1
Immunogen: EDA (NP_001390.1 , 245 a.a. ~ 391 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Protein accession: NP_001390.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001896-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (18.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EDA monoclonal antibody (M01), clone 3E12 now

Add to cart