Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ECHS1 monoclonal antibody (M09), clone 3D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ECHS1 monoclonal antibody (M09), clone 3D8
| Brand: | Abnova |
| Reference: | H00001892-M09 |
| Product name: | ECHS1 monoclonal antibody (M09), clone 3D8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ECHS1. |
| Clone: | 3D8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1892 |
| Gene name: | ECHS1 |
| Gene alias: | SCEH |
| Gene description: | enoyl Coenzyme A hydratase, short chain, 1, mitochondrial |
| Genbank accession: | BC008906 |
| Immunogen: | ECHS1 (AAH08906.1, 13 a.a. ~ 290 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
| Protein accession: | AAH08906.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |