Brand: | Abnova |
Reference: | H00001871-M04 |
Product name: | E2F3 monoclonal antibody (M04), clone 3C11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant E2F3. |
Clone: | 3C11 |
Isotype: | IgG2b Kappa |
Gene id: | 1871 |
Gene name: | E2F3 |
Gene alias: | DKFZp686C18211|E2F-3|KIAA0075|MGC104598 |
Gene description: | E2F transcription factor 3 |
Genbank accession: | BC016847.1 |
Immunogen: | E2F3 (AAH16847.1, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV |
Protein accession: | AAH16847.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged E2F3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |