| Brand: | Abnova |
| Reference: | H00001871-M01 |
| Product name: | E2F3 monoclonal antibody (M01), clone 5F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant E2F3. |
| Clone: | 5F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1871 |
| Gene name: | E2F3 |
| Gene alias: | DKFZp686C18211|E2F-3|KIAA0075|MGC104598 |
| Gene description: | E2F transcription factor 3 |
| Genbank accession: | NM_001949 |
| Immunogen: | E2F3 (NP_001940, 336 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNL |
| Protein accession: | NP_001940 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | E2F3 monoclonal antibody (M01), clone 5F7 Western Blot analysis of E2F3 expression in COLO 320 HSR ( Cat # L020V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |