Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DVL3 monoclonal antibody (M04A), clone 4H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about DVL3 monoclonal antibody (M04A), clone 4H2
| Brand: | Abnova |
| Reference: | H00001857-M04A |
| Product name: | DVL3 monoclonal antibody (M04A), clone 4H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DVL3. |
| Clone: | 4H2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1857 |
| Gene name: | DVL3 |
| Gene alias: | KIAA0208 |
| Gene description: | dishevelled, dsh homolog 3 (Drosophila) |
| Genbank accession: | BC032459 |
| Immunogen: | DVL3 (AAH32459, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP |
| Protein accession: | AAH32459 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DVL3 monoclonal antibody (M04A), clone 4H2 Western Blot analysis of DVL3 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |