| Brand: | Abnova |
| Reference: | H00001855-A01 |
| Product name: | DVL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DVL1. |
| Gene id: | 1855 |
| Gene name: | DVL1 |
| Gene alias: | DVL|MGC54245 |
| Gene description: | dishevelled, dsh homolog 1 (Drosophila) |
| Genbank accession: | NM_182779 |
| Immunogen: | DVL1 (NP_877580, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG |
| Protein accession: | NP_877580 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z. BMC Cancer. 2007 Mar 27;7:55. |