View larger

DUSP5 monoclonal antibody (M05), clone 6D1

Reference:

Condition: New product

Data sheet of DUSP5 monoclonal antibody (M05), clone 6D1

Brand:	Abnova
Reference:	H00001847-M05
Product name:	DUSP5 monoclonal antibody (M05), clone 6D1
Product description:	Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Clone:	6D1
Isotype:	IgG1 Kappa
Gene id:	1847
Gene name:	DUSP5
Gene alias:	DUSP\|HVH3
Gene description:	dual specificity phosphatase 5
Genbank accession:	NM_004419
Immunogen:	DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Protein accession:	NP_004410
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged DUSP5 is approximately 0.03ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice