| Brand: | Abnova |
| Reference: | H00001847-M04 |
| Product name: | DUSP5 monoclonal antibody (M04), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DUSP5. |
| Clone: | 2F3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1847 |
| Gene name: | DUSP5 |
| Gene alias: | DUSP|HVH3 |
| Gene description: | dual specificity phosphatase 5 |
| Genbank accession: | NM_004419 |
| Immunogen: | DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
| Protein accession: | NP_004410 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DUSP5 monoclonal antibody (M04), clone 2F3 Western Blot analysis of DUSP5 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Zinc-Finger Nuclease Knockout of Dual-Specificity Protein Phosphatase-5 Enhances the Myogenic Response and Autoregulation of Cerebral Blood Flow in FHH.1BN Rats.Fan F, Geurts AM, Pabbidi MR, Smith SV, Harder DR, Jacob H, Roman RJ PLoS One. 2014 Nov 14;9(11):e112878. doi: 10.1371/journal.pone.0112878. eCollection 2014. |