| Brand: | Abnova |
| Reference: | H00001847-M02A |
| Product name: | DUSP5 monoclonal antibody (M02A), clone 3D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DUSP5. |
| Clone: | 3D8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1847 |
| Gene name: | DUSP5 |
| Gene alias: | DUSP|HVH3 |
| Gene description: | dual specificity phosphatase 5 |
| Genbank accession: | NM_004419 |
| Immunogen: | DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
| Protein accession: | NP_004410 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DUSP5 monoclonal antibody (M02A), clone 3D8 Western Blot analysis of DUSP5 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |