| Brand: | Abnova |
| Reference: | H00001843-A01 |
| Product name: | DUSP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DUSP1. |
| Gene id: | 1843 |
| Gene name: | DUSP1 |
| Gene alias: | CL100|HVH1|MKP-1|MKP1|PTPN10 |
| Gene description: | dual specificity phosphatase 1 |
| Genbank accession: | NM_004417 |
| Immunogen: | DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC |
| Protein accession: | NP_004408 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (6.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |