No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00001839-M01 |
Product name: | HBEGF monoclonal antibody (M01), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HBEGF. |
Clone: | 1G11 |
Isotype: | IgG1 Kappa |
Gene id: | 1839 |
Gene name: | HBEGF |
Gene alias: | DTR|DTS|DTSF|HEGFL |
Gene description: | heparin-binding EGF-like growth factor |
Genbank accession: | BC033097 |
Immunogen: | HBEGF (AAH33097.1, 20 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH |
Protein accession: | AAH33097.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |