Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 749,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 749,00 €
Data sheet of DTNB monoclonal antibody (M03), clone 1D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about DTNB monoclonal antibody (M03), clone 1D3
| Brand: | Abnova |
| Reference: | H00001838-M03 |
| Product name: | DTNB monoclonal antibody (M03), clone 1D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DTNB. |
| Clone: | 1D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1838 |
| Gene name: | DTNB |
| Gene alias: | MGC17163|MGC57126 |
| Gene description: | dystrobrevin, beta |
| Genbank accession: | NM_183361 |
| Immunogen: | DTNB (NP_899205, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY |
| Protein accession: | NP_899205 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DTNB is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |